PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.300610.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family WRKY
Protein Properties Length: 333aa    MW: 36113 Da    PI: 6.4176
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.300610.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY107.85.5e-34157214259
                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                     +Dgy+WrKYGqK vk+s+fprsYYrCtsa C+vkk+vers  dp+vv++tYeg+H+h+
  Cucsa.300610.1 157 EDGYRWRKYGQKAVKNSPFPRSYYRCTSAACNVKKRVERSFADPTVVVTTYEGQHTHP 214
                     8********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.0E-34141216IPR003657WRKY domain
SuperFamilySSF1182907.59E-29148216IPR003657WRKY domain
PROSITE profilePS5081131.95151216IPR003657WRKY domain
SMARTSM007742.9E-40156215IPR003657WRKY domain
PfamPF031062.4E-26157214IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009624Biological Processresponse to nematode
GO:0009733Biological Processresponse to auxin
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MEDYNNNNDD DQQQIIKIED TSTITDAGGG GDGGGRGGGG GGVFSFSDNI IPNGLFDFCD  60
SDKCSVGFME LLGLNYNSEF TEAFNNPPAT PNCSSSVSSA SSDALNDDEP PPPPPPQQQQ  120
QHSPTKQLKG IKKRKEKEKE KKARFAFMTK SEVDHLEDGY RWRKYGQKAV KNSPFPRSYY  180
RCTSAACNVK KRVERSFADP TVVVTTYEGQ HTHPSPILSR SALAVAIPPP SFIPGAGGEC  240
VGGVVAMPWL KPSNNDAHDG NTIPAMSHQY FQNSTYITAQ NVAANYNRNN HIGAANAAGI  300
LQEKRFCNPN SSFLVDHGLL QDVVPPHMLK QE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A6e-27146216777Probable WRKY transcription factor 4
1wj2_A6e-27146216777Probable WRKY transcription factor 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13341GGRGGGGGG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00069PBMTransfer from AT2G47260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU9840400.0GU984040.1 Cucumis sativus WRKY protein (WRKY55) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011651538.10.0PREDICTED: probable WRKY transcription factor 68 isoform X1
RefseqXP_011651539.10.0PREDICTED: probable WRKY transcription factor 68 isoform X1
TrEMBLE7CEY90.0E7CEY9_CUCSA; WRKY protein
STRINGGLYMA10G01450.12e-61(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF100234114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47260.12e-45WRKY DNA-binding protein 23